« Back
Home /
Anti-BRCA1 Antibody [17F8]

Anti-BRCA1 Antibody [17F8]

Item no.	ANTI-A279060-50
Manufacturer	Antibodies.com
Amount	50ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Liquid
Applications	WB, IF, IP, ELISA, IHC-P
Clone	17F8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1
Conjugate/Tag	Unconjugated
Sequence	RSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGN
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Specificity	This antibody recognises both human and recognises full length 220 kDa BRCA1, but not the delta exon 11 splice variant. Mouse anti BRCA1, clone17F8 is well documented for use in immunohistochemistry and immunofluorescence staining, showning that this anti
Product Description	Mouse monoclonal [17F8] antibody to BRCA1.
Clonality	Monoclonal
Immunogen	E. coli derived recombinant BRCA1 protein fragment corresponding to amino acids 762-1315.
Concentration	1 mg/ml
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.
Protein Length	554
Amino acids	aa 762 - 1315
Purification	Protein G affinity chromatography of ascites.
Storage	Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Recommended dilutions	IF: 1 µg/ml, WB: 1.0 - 10.0 µg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer