« Back
Home /
Anti-PDIA4 Antibody

Anti-PDIA4 Antibody

Item no.	ANTI-A9438-100
Manufacturer	Antibodies.com
Amount	100 ul
Category	Antibodies Immunohistochemistry Western Blot Immunocytochemistry Primary Antibodies Immunochemistry
Type	Antibody Primary
Format	Liquid
Applications	WB, IHC, ICC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Manufacturer - Targets	ERp72
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description	Rabbit polyclonal antibody to ERp72.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDIA4 (NP_004902.1).
Manufacturer - Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glyercol and 0.05% Proclin 300.
Purification	Affinity purification.
Recommended dilutions	WB: 1:500-1:1, 000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Molecular weight	72 kDa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/6/2025

Compare

Add to wishlist

Get an offer

Request delivery time