Comparison

Anti-MYLK3 Antibody European Partner

Item no. ANTI-A9958-200
Manufacturer Antibodies.com
Amount 200 ul
Category
Type Antibody Primary
Applications WB, IF
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Sequence MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Available
Manufacturer - Targets
MYLK3
Storage Conditions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description
Rabbit polyclonal antibody to MYLK3.
Clonality
Polyclonal
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MYLK3 (NP_872299.2).
Manufacturer - Formulation
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification
Affinity purification.
Recommended dilutions
WB: 1:500-1:2000, IF: 1:50-1:100

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close