« Back
Home /
Pancreastatin - 1 mg

Pancreastatin - 1 mg

Item no.	AS-65657
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Pancreastatin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3283.53
Description	Pancreastatin (24-52) or hPST29 peptide is one of the active short variants of the full-length peptide. It inhibits production of glycogen and regulates glucose-induced insulin secretion, lipid and protein metabolism in adipose tissue and liver.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism / Lyophilized
Sequence One-Letter Code	PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2
Long Name	Pancreastatin, 1mg
GTIN	5400535195724
Usage	Research use

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer