Haptoglobin, Bovine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Bovine
Amount 0.2mg
Host Bovine
ArtNr PH30542
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid, PBS buffer
Sequence
MSALQAVVTLLLCGQLLAVETGSEATADSCPKAPE IANSHVEYSVRYQCDKYYKLHAGNG VYTFNNKQW INKDIGQQLPECEEDDSCPEPPKIENGYVEYLVRY QCKPYYTLRTCGDGVY TFNSKKQWINKNIGQKLP ECEAVCGKPKHPVDQVQRIIGGSLDAKGSFPWQAK MVSQHNL ISGATLINERWLLTTAKNLYLGHSSDK KAKDITPTLRLYVGKNQLVEVEKVVLHPDHSKV D IGLIKLRQKVPVNDKVMPICLPSKDYVKVGRVGYV SGWGRNENFNFTEHLKYVMLPVAD QDKCVKHYEG VDAPKNKTAKSPVGVQPILNENTFCVGLSKYQDDT CYGDAGSAFVVHDKE DDTWYAAGILSFDKSCAVA EYGVYVKVTSILDWVRKTIANN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
280692
Omim
140100
Swiss Prot
Q2TBU0
Unigene
Bt.12553
Molecular Weight
45 kDa
Amount: 0.2mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close