Plasminogen, Bovine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Bovine
Amount 1mg
Host Bovine
ArtNr PP12101
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 50 mM Tris-HCl/0.1 M NaCl/pH 7.4
Sequence
DLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKCE EETDFVCRAFQYHSKEQQCVVMAENSKNTPVFRMR DVILYEKRIYLLECKTGNGQTYRGTTAETKSGVTC QKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDE NGPWCYTTDPDKRYDYCDIPECEDKCMHCSGENYE GKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL KMNYCRNPDGEPRPWCFTTDPQKRWEFCDIPRCTT PPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRW SEQTPHKHNRTPENFPCKNLEENYCRNPNGEKAPW CYTTNSEVRWEYCTIPSCESSPLSTERMDVPVPPE QTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSM TPHRHLKTPENYPNAGLTMNYCRNPDADKSPWCYT TDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPP EADCMIGTGKSYRGKKATTVAGVPCQEWAAQEPHQ HSIFTPETNPQSGLERNYCRNPDGDVNGPWCYTMN PRKPFDYCDVPQCESSFDCGKPKVEPKKCSGRIVG GCVSKPHSWPWQVSLRRSSRHFCGGTLISPKWVLT AAHCLDNILALSFYKVILGAHNEKVREQSVQEIPV SRLFREPSQADIALLKLSRPAIITKEVIPACLPPP NYMVAARTECYITGWGETQGTFGEGLLKEAHLPVI ENKVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGD SGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYV RVSPYVPWIEETMRRN
Storage
-60C or below
Associated Disease
Glomerulonephritis, Cardiovascular
Entrez Gene
-
Omim
-
Molecular Weight
90 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close