Apolipoprotein AI, High Density, Human Plasma

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 500ug
Host Human
ArtNr PA20011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 10 mM NH4HCO3, pH 7.4
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRV KDLATVYVDVLKDSGRDYVSQFEGS ALGKQLNLK LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETE GLRQEMSKDLEEVKAK VQPYLDDFQKKWQEEMEL YRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR DRARAHV DALRTHLAPYSDELRQRLAARLEALKE NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ G LLPVLESFKVSFLSALEEYTKKLNTQ
Storage
-60C or below
Associated Disease
Cardiovascular, Heart Disease, Cancer, Metabolism
Entrez Gene
335
Omim
107680
Swiss Prot
P02647
Unigene
Hs.93194
Molecular Weight
31 kDa
Amount: 500ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close