Apolipoprotein B, Low Density, Human Plasma

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 500ug
Host Human
ArtNr PA20041
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 10 mM Na deoxycholate, pH 10.0, with 50 mM Na2CO3 and 50 mM NaCl
Sequence
MDPPRPALLALLALPALLLLLLAGARAEEEMLENV SLVCPKDATRFKHLRKYTYNYEAES SSGVPGTAD SRSATRINCKVELEVPQLCSFILKTSQCTLKEVYG FNPEGKALLKKTKNSE EFAAAMSRYELKLAIPEG KQVFLYPEKDEPTYILNIKRGIISALLVPPETEEA KQVLFLD TVYGNCSTHFTVKTRKGNVATEISTER DLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS S SQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKY GMVAQVTQTLKLEDTPKINSRFFG EGTKKMGLAF ESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRA NLFNKLVTELRGLSD EAVTSLLPQLIEVSSPITL QALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYL VALIPE PSAQQLREIFNMARDQRSRATLYALSHA VNNYHKTNPTGTQELLDIANYLMEQIQDDCTG DE DYTYLILRVIGNMGQTMEQLTPELKSSILKCVQST KPSLMIQKAAIQALRKMEPKDKD QEVLLQTFLDD ASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQN EQVKNFVASHIANI LNSEELDIQDLKKLVKEALK ESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKI EGNLI FDPNNYLPKESMLKTTLTAFGFASADLIE IGLEGKGFEPTLEALFGKQGFFPDSVNKALY WVN GQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSV EKLIKDLKSKEVPEARAYLRIL GEELGFASLHDL QLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFL HYIFMENAFELPT GAGLQLQISSSGVIAPGAKAG VKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFAR SGVQ MNTNFFHESGLEAHVALKAGKLKFIIPSPK RPVKLLSGGNTLHLVSTTKTEVIPPLIENR QSWS VCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDT RLELELRPTGEIEQYSVSATY ELQREDRALVDTL KFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPD FDVDLGTILRVN DESTEGKTSYRLTLDIQNKKIT EVALMGHLSCDTKEERKIKGVISIPRLQAEARSEI LAH WSPAKLLLQMDSSATAYGSTVSKRVAWHYDE EKIEFEWNTGTNVDTKKMTSNFPVDLSDY PKSLH MYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQK ASGSLPYTQTLQDHLNSLKE FNLQNMGLPDFHIP ENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRD LKMLETVRTPA LHFKSVGFHLPSREFQVPTFTIP KLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNT ST DHFSLRARYHMKADSVVDLLSYNVQGSGETTY DHKNTFTLSYDGSLRHKFLDSNIKFSHV EKLGNN PVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFV KEVKIDGQFRVSSFYAKGT YGLSCQRDPNTGRLN GESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDL QSGIIKNTAS LKYENYELTLKSDTNGKYKNFATS NKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSL N SHGLELNADILGTDKINSGAHKATLRIGQDGIS TSATTNLKCSLLVLENELNAELGLSGA SMKLTTN GRFREHNAKFSLDGKAALTELSLGSAYQAMILGVD SKNIFNFKVSQEGLKLSN DMMGSYAEMKFDHTNS LNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPY SLVTTLNSD LKYNALDLTNNGKLRLEPLKLHVAG NLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSN VFRSVMAPFTMTIDAHTNGNGKLALW GEHTGQLY SKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAA LEHKVSALLTPAEQTGT WKLKTQFNNNEYSQDLD AYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSE PINIIDAL EMRDAVEKPQEFTIVAFVKYDKNQDV HSINLPFFETLQEYFERNRQTIIVVLENVQRNLK HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQV SHAKEKLTALTKKYRITENDIQIAL DDAKINFNE KLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDE IIEKLKSLDEHYHIRV NLVKTIHDLHLFIENIDF NKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHI QNIDIQH LAGKLKQHIEAIDVRVLLDQLGTTISF ERINDILEHVKHFVINLIGDFEVAEKINAFRAK V HELIERYEVDQQIQVLMDKLVELAHQYKLKETIQK LSNVLQQVKIKDYFEKLVGFIDDA VKKLNELSFK TFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIRE VTQRLNGEIQALELP QKAEALKLFLEETKATVAV YLESLQDTKITLIINWLQEALSSASLAHMKAKFRE TLEDTR DRMYQMDIQQELQRYLSLVGQVYSTLVT YISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL VE QGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDF IVPLTDLRIPSVQINFKDLKNIK IPSRFSTPEFT ILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQW PVPDIYLRDLKVED IPLARITLPDFRLPEIAIPE FIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTF GKLYS ILKIQSPLFTLDANADIGNGTTSANEAGI AASITAKGESKLEVLNFDFQANAQLSNPKIN PLA LKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVA SLHTEKNTLELSNGVIVKINNQ LTLDSNTKYFHK LNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKG SWKWACPRFSDEG THESQISFTIEGPLTSFGLSN KINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQH VGHS VLTAKGMALFGEGKAEFTGRHDAHLNGKVI GTLKNSLFFSAQPFEITASTNNEGNLKVRF PLRL TGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYN QNFSAGNNENIMEAHVGINGE ANLDFLNIPLTIP EMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQS FDLSVKAQYKKN KHRHSITNPLAVLCEFISQSIK SFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEK SHD ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFG YVFPKAVSMPSFSILGSDVRVPSYTLILP SLELP VLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYD FSFKSSVITLNTNAELFNQS DIVAHLLSSSSSVI DALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS HNSTVSLTTKN MEVSVATTTKAQIPILRMNFKQE LNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVD HK LSLESLTSYFSIESSTKGDVKGSVLSREYSGT IASEANTYLNSKSTRSSVKLQGTSKIDD IWNLEV KENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNG EHTSKATLELSPWQMSALV QVHASQPSSFHDFPD LGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVEL SNDQEKAHLD IAGSLEGHLRFLKNIILPVYDKSL WDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSF S IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPF TDLQVPSCKLDFREIQIYKKLRTSSFA LNLPTLP EVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTV SQFTLPKSVSDGIAALDL NAVANKIADFELPTII VPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDS PVYNATWSA SLKNKADYVETVLDSTCSSTVQFLE YELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDK KGISTSAASPAVGTVGMDMDEDDDFS KWNFYYSP QSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAA SGLLTSLKDNVPKATGV LYDYVNKYHWEHTGLTL REVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQK AASGTTGT YQEWKDKAQNLYQELLTQEGQASFQG LKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKV HNGSEILFSYFQDLVITLPFELRKH KLIDVISMY RELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQ FIFQLIEDNIKQLKEM KFTYLINYIQDEINTIFS DYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQE LQQIHQY IMALREEYFDPSIVGWTVKYYELEEKI VSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV E QFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEI IKSQAIATKKIISDYHQQFRYKLQ DFSDQLSDYY EKFIAESKRLIDLSIQNYHTFLIYITELLKKLQST TVMNPYMKLAPGELT IIL
Storage
-60C or below
Associated Disease
Cardiovascular, Cancer, Heart Disease
Entrez Gene
338
Omim
107730
Swiss Prot
P04114
Unigene
Hs.120759
Molecular Weight
550 kDa
Amount: 500ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close