Apolipoprotein CII, Human Plasma, Very Low Density Lipoprotein

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 50ug
Host Human
ArtNr PA20061
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 10 mM NH4HCO3, pH 7.4
Sequence
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQN LYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQ VLSVLKGEE
Storage
-60C or below
Associated Disease
Cardiovascular, Cancer, Heart Disease
Entrez Gene
344
Omim
608083
Swiss Prot
P02655
Unigene
Hs.75615
Molecular Weight
9 kDa
Amount: 50ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close