Lipoprotein a, [Lp(a)], Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 50ug
Host Human
ArtNr PA20101
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 50 mM Tris-HCl with 0.5 M NaCl, pH 8.2, 0.1% EDTA and 0.05% NaN3
Sequence
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQS YRGTYSTTVTGRTCQAWSSMTPHQH NRTTENYPN AGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQ CSDAEGTAVAPPTVTP VPSLEAPSEQAPTEQRPG VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHS HSRTPEY YPNAGLIMNYCRNPDAVAAPYCYTRDP GVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA P SEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT CQAWSSMTPHSHSRTPEYYPNAGL IMNYCRNPDA VAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPT VTPVPSLEAPSEQAP TEQRPGVQECYHGNGQSYR GTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL IMNYCR NPDAVAAPYCYTRDPGVRWEYCNLTQCS DAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG VQ ECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHS RTPEYYPNAGLIMNYCRNPDAVA APYCYTRDPGV RWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQ APTEQRPGVQECYH GNGQSYRGTYSTTVTGRTCQ AWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAA PYCYT RDPGVRWEYCNLTQCSDAEGTAVAPPTVT PVPSLEAPSEQAPTEQRPGVQECYHGNGQSY RGT YSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIM NYCRNPDAVAAPYCYTRDPGVR WEYCNLTQCSDA EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECY HGNGQSYRGTYST TVTGRTCQAWSSMTPHSHSRT PEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWE YCNL TQCSDAEGTAVAPPTVTPVPSLEAPSEQAP TEQRPGVQECYHGNGQSYRGTYSTTVTGRT CQAW SSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPY CYTRDPGVRWEYCNLTQCSDA EGTAVAPPTVTPV PSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST TVTGRTCQAWSS MTPHSHSRTPEYYPNAGLIMNY CRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGT AVA PPTVTPVPSLEAPSEQAPTEQRPGVQECYHG NGQSYRGTYSTTVTGRTCQAWSSMTPHSH SRTPE YYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYC NLTQCSDAEGTAVAPPTVTP VPSLEAPSEQAPTE QRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSM TPHSHSRTPEY YPNAGLIMNYCRNPDAVAAPYCY TRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSL EA PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTV TGRTCQAWSSMTPHSHSRTPEYYPNAGL IMNYCR NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAV APPTVTPVPSLEAPSEQAP TEQRPGVQECYHGNG QSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYP NAGLIMNYCR NPDAVAAPYCYTRDPGVRWEYCNL TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRP G VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTP HSHSRTPEYYPNAGLIMNYCRNPDAVA APYCYTR DPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA PSEQAPTEQRPGVQECYH GNGQSYRGTYSTTVTG RTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPD AVAAPYCYT RDPGVRWEYCNLTQCSDAEGTAVAP PTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNA GLIMNYCRNPDAVAAPYCYTRDPGVR WEYCNLTQ CSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGV QECYHGNGQSYRGTYST TVTGRTCQAWSSMTPHS HSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPG VRWEYCNL TQCSDAEGTAVAPPTVTPVPSLEAPS EQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAV AAPYCYTRDPGVRWEYCNLTQCSDA EGTAVAPPT VTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRG TYSTTVTGRTCQAWSS MTPHSHSRTPEYYPNAGL IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSD AEGTAVA PPTVTPVPSLEAPSEQAPTEQRPGVQE CYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSH S RTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR WEYCNLTQCSDAEGTAVAPPTVTP VPSLEAPSEQ APTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQA WSSMTPHSHSRTPEY YPNAGLIMNYCRNPDAVAA PYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP VPSLEA PSEQAPTEQRPGVQECYHGNGQSYRGTY STTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL IM NYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAE GTAVAPPTVTPVPSLEAPSEQAP TEQRPGVQECY HGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTP EYYPNAGLIMNYCR NPDAVAAPYCYTRDPGVRWE YCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPT EQRPG VQECYHGNGQSYRGTYSTTVTGRTCQAWS SMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA APY CYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVP SLEAPSEQAPTEQRPGVQECYH GNGQSYRGTYST TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYC RNPDAVAAPYCYT RDPGVRWEYCNLTQCSDAEGT AVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGN GQSY RGTYSTTVTGRTCQAWSSMTPHSHSRTPEY YPNAGLIMNYCRNPDAVAAPYCYTRDPGVR WEYC NLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQ RPGVQECYHGNGQSYRGTYST TVTGRTCQAWSSM TPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT RDPGVRWEYCNL TQCSDAEGTAVAPPTVTPVPSL EAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVT GRT CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRN PDAVAAPYCYTRDPGVRWEYCNLTQCSDA EGTAV APPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQ SYRGTYSTTVTGRTCQAWSS MTPHSHSRTPEYYP NAGLIMNYCRNPDPVAAPYCYTRDPSVRWEYCNLT QCSDAEGTAVA PPTITPIPSLEAPSEQAPTEQRP GVQECYHGNGQSYQGTYFITVTGRTCQAWSSMTPH SH SRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTD PSVRWEYCNLTRCSDAEWTAFVPPNVIL APSLEA FFEQALTEETPGVQDCYYHYGQSYRGTYSTTVTGR TCQAWSSMTPHQHSRTPEN YPNAGLTRNYCRNPD AEIRPWCYTMDPSVRWEYCNLTQCLVTESSVLATL TVVPDPSTEA SSEEAPTEQSPGVQDCYHGDGQSY RGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGG L TRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQC PVTESSVLATSTAVSEQAPTEQSPTVQ DCYHGDG QSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYP NGGLTRNYCRNPDAEIRP WCYTMDPSVRWEYCNL TQCPVMESTLLTTPTVVPVPSTELPSEEAPTENST GVQDCYRGD GQSYRGTLSTTITGRTCQSWSSMTP HWHRRIPLYYPNAGLTRNYCRNPDAEIRPWCYTMD PSVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEA PSEQAPPEKSPVVQDCYHGDGRSYRG ISSTTVTG RTCQSWSSMIPHWHQRTPENYPNAGLTENYCRNPD SGKQPWCYTTDPCVRWE YCNLTQCSETESGVLET PTVVPVPSMEAHSEAAPTEQTPVVRQCYHGNGQSY RGTFSTTV TGRTCQSWSSMTPHRHQRTPENYPND GLTMNYCRNPDADTGPWCFTMDPSIRWEYCNLTR CSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKG YRGKKATTVTGTPCQEWAAQEPHRH STFIPGTNK WAGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDI PLCASSSFDCGKPQVE PKKCPGSIVGGCVAHPHS WPWQVSLRTRFGKHFCGGTLISPEWVLTAAHCLKK SSRPSSY KVILGAHQEVNLESHVQEIEVSRLFLE PTQADIALLKLSRPAVITDKVMPACLPSPDYMV T ARTECYITGWGETQGTFGTGLLKEAQLLVIENEVC NHYKYICAEHLARGTDSCQGDSGG PLVCFEKDKY ILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMM RNN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
4018
Omim
152200
Swiss Prot
P08519
Unigene
Hs.520120
Molecular Weight
501 kDa
Amount: 50ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close