Serum amyloid A, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 25ug
Host Human
Item no. PA22311
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in PBS buffer
Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDM WRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV WAAEAISDARENIQRFFGHGAEDSLADQAANEWGR SGKDPNHFRPAGLPEKY
Storage
-60C or below
Associated Disease
Diabetes, Cancer
Entrez Gene
6288, 6289
Omim
104750, 104751
Swiss Prot
P0DJI8, P0DJI9
Unigene
Hs.632144, Hs.731376, Hs.734161
Molecular Weight
14 kDa
Amount: 25ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close