Alpha 2 Macroglobulin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PA50011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 30 mM sodium phosphate, pH 7.0 , with glycine as a stabilizer
Sequence
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLV PSLLHTETTEKGCVLLSYLNETVTVSASLESVRGN RSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTV QVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKP GQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRI AQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKK SGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEE MNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHG EDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKE YEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKL SFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIF IRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPS KSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGL KKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFS ISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDV ENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVC ALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGF PGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKD MYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGP EGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYF PETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAF CLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRG EAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAE ALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGL EKETTFNSLLCPSGGEVSEELSLKLPPNVVEESAR ASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLF APNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQ LNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFA QARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGS LLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPV VRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFA LAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPK APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTS EDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNN NRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKY NILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISL SVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLE RSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQ DVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKD LGNA
Storage
-60C or below
Associated Disease
Multiple Sclerosis (MS), Glomerular Disease, Liver Disease
Entrez Gene
2
Omim
103950
Swiss Prot
P01023
Unigene
Hs.212838
Product References
Molecular Weight
163 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close