Apolipoprotein-H , Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PA70152
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.15 M NaCl/ pH 8.0
Sequence
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPG YVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGI LENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKC TEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPS AGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNW TKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDK ATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASC KVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFF CKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAF WKTDASDVKPC
Storage
-60C or below
Associated Disease
Cardiovascular, Metabolism, Cancer
Entrez Gene
350
Omim
138700
Swiss Prot
P02749
Unigene
Hs.445358
Molecular Weight
48 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Instruction sheet

PA70152.pdf