Haptoglobin, Human Plasma, Mixed Type

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 1mg
Host Human
Item no. PH30011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized, salt free
Sequence
MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPK PPEIAHGYVEHSVRYQCKNYYKLRT EGDGVYTLN DKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVE HSVRYQCKNYYKLRTE GDGVYTLNNEKQWINKAV GDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSF PWQAKMV SHHNLTTGATLINEQWLLTTAKNLFLN HSENATAKDIAPTLTLYVGKKQLVEIEKVVLHP N YSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVG RVGYVSGWGRNANFKFTDHLKYVM LPVADQDQCI RHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSK YQEDTCYGDAGSAFA VHDLEEDTWYATGILSFDK SCAVAEYGVYVKVTSIQDWVQKTIAEN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
3240
Omim
140100
Swiss Prot
P00738
Unigene
Hs.513711, Hs.702099
Molecular Weight
45 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close