Neutrophil Elastase, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PN31255
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
50 mM sodium acetate, pH 5.5, 0.6 M sodium chloride
Sequence
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRR ARPHAWPFMVSLQLRGGHFCGATLI APNFVMSAA HCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRI FENGYDPVNLLNDIVI LQLNGSATINANVQVAQL PAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELN VTVVTSL CRRSNVCTLVRGRQAGVCFGDSGSPLV CNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN W IDSIIQRSEDNPCPHPRDPDPASRTH
Storage
-60C or below
Associated Disease
Microbiology
Entrez Gene
1991
Omim
130130
Swiss Prot
P08246
Unigene
Hs.99863
Molecular Weight
30 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close