Plasminogen, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PP12001
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, =90% by SDS-PAGE
Presentation
Liquid in 50 mM Tris-HCl/0.1 M NaCl/pH 7.4
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFS VTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKE QQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKT GNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPA THPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDY CDILECEEECMHCSGENYDGKISKTMSGLECQAWD SQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWC FTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTG ENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFP CKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIP SCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSY RGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCS GTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYR GKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAG LEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQ VSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRP SSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKD IALLKLSSPAVITDKVIPACLPSPNYVVADRTECF ITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFL NGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKD KYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEG VMRNN
Storage
-60C or below
Associated Disease
Glomerulonephritis, Cardiovascular
Entrez Gene
5340
Omim
173350
Swiss Prot
P00747
Unigene
Hs.143436
Molecular Weight
91 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close