Prealbumin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PP65325
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 50 mM Na phosphate, pH 7.5, with 150 mM NaCl
Sequence
MASHRLLLLCLAGLVFVSEAGPTGTGESKCPLMVK VLDAVRGSPAINVAVHVFRKAADDT WEPFASGKT SESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGI SPFHEHAEVVFTANDS GPRRYTIAALLSPYSYST TAVVTNPKE
Storage
-60C or below
Associated Disease
Kidney Disease
Entrez Gene
7276
Omim
176300
Swiss Prot
P02766
Unigene
Hs.427202
Molecular Weight
55 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close