TF Lipoprotein, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ng
ArtNr PT1002a
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
rhTF lipoprotein lyophilized from 10 mM Tris, 150 mM NaCl,
pH 7.5, BSA
Sequence
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGT TNTVAAYNLTWKSTNFKTILEWEPK PVNQVYTVQ ISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYL ARVFSYPAGNVESTGS AGEPLYENSPEFTPYLET NLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFL SLRDVFG KDLIYTLYYWKSSSSGKKTAKTNTNEF LIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE C MGQEKGEFREIFYIIGAVVFVVIILVIILAISLHK CRKAGVGQSWKENSPLNVS
Storage
-60C or below
Associated Disease
Cardiovascular, Metabolism
Entrez Gene
2152
Omim
134390
Swiss Prot
P13726
Unigene
Hs.62192
Product References
Molecular Weight
33 kDa
Amount: 100ng
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close