TF Lipoprotein, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 100ng
ArtNr PT1002a
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
rhTF lipoprotein lyophilized from 10 mM Tris, 150 mM NaCl,
pH 7.5, BSA
Sequence
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGT TNTVAAYNLTWKSTNFKTILEWEPK PVNQVYTVQ ISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYL ARVFSYPAGNVESTGS AGEPLYENSPEFTPYLET NLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFL SLRDVFG KDLIYTLYYWKSSSSGKKTAKTNTNEF LIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE C MGQEKGEFREIFYIIGAVVFVVIILVIILAISLHK CRKAGVGQSWKENSPLNVS
Storage
-60C or below
Associated Disease
Cardiovascular, Metabolism
Entrez Gene
2152
Omim
134390
Swiss Prot
P13726
Unigene
Hs.62192
Product References
Molecular Weight
33 kDa
Amount: 100ng
Available: Out of stock
Listprice: €478.00
Price: €478.00
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close