Alpha Macroglobulin, Mouse

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Mouse
Amount 0.1mg
Host Mouse
ArtNr PM71121
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
150mM sodium chloride, 10mM sodium phosphate, 0.1% sodium azide, pH 7.2
Sequence
MRRNQLPTPAFLLLFLLLPRDATTATAKPQYVVLV PSEVYSGVPEKACVSLNHVNETVMLSLTLEYAMQQ TKLLTDQAVDKDSFYCSPFTISGSPLPYTFITVEI KGPTQRFIKKKSIQIIKAESPVFVQTDKPIYKPGQ IVKFRVVSVDISFRPLNETFPVVYIETPKRNRIFQ WQNIHLAGGLHQLSFPLSVEPALGIYKVVVQKDSG KKIEHSFEVKEYVLPKFEVIIKMQKTMAFLEEELP ITACGVYTYGKPVPGLVTLRVCRKYSRYRSTCHNQ NSMSICEEFSQQADDKGCFRQVVKTKVFQLRQKGH DMKIEVEAKIKEEGTGIELTGIGSCEIANALSKLK FTKVNTNYRPGLPFSGQVLLVDEKGKPIPNKNITS VVSPLGYLSIFTTDEHGLANISIDTSNFTAPFLRV VVTYKQNHVCYDNWWLDEFHTQADHSATLVFSPSQ SYIQLELVFGTLACGQTQEIRIHYLLNEDIMKNEK DLTFYYLIKARGSIFNLGSHVLSLEQGNMKGVFSL PIQVEPGMAPEAQLLIYAILPNEELVADAQNFEIE KCFANKVNLSFPSAQSLPASDTHLKVKAAPLSLCA LTAVDQSVLLLKPEAKLSPQSIYNLLPGKTVQGAF FGVPVYKDHENCISGEDITHNGIVYTPKHSLGDND AHSIFQSVGINIFTNSKIHKPRFCQEFQHYPAMGG VAPQALAVAASGPGSSFRAMGVPMMGLDYSDEINQ VVEVRETVRKYFPETWIWDLVPLDVSGDGELAVKV PDTITEWKASAFCLSGTTGLGLSSTISLQAFQPFF LELTLPYSVVRGEAFTLKATVLNYMSHCIQIRVDL EISPDFLAVPVGGHENSHCICGNERKTVSWAVTPK SLGEVNFTATAEALQSPELCGNKLTEVPALVHKDT VVKSVIVEPEGIEKEQTYNTLLCPQDTELQDNWSL ELPPNVVEGSARATHSVLGDILGSAMQNLQNLLQM PYGCGEQNMVLFVPNIYVLNYLNETQQLTEAIKSK AINYLISGYQRQLNYQHSDGSYSTFGNHGGGNTPG NTWLTAFVLKAFAQAQSHIFIEKTHITNAFNWLSM KQKENGCFQQSGYLLNNAMKGGVDDEVTLSAYITI ALLEMPLPVTHSAVRNALFCLETAWASISQSQESH VYTKALLAYAFALAGNKAKRSELLESLNKDAVKEE DSLHWQRPGDVQKVKALSFYQPRAPSAEVEMTAYV LLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQ NSHGGFSSTQDTVVALQALSKYGAATFTRSQKEVL VTIESSGTFSKTFHVNSGNRLLLQEVRLPDLPGNY VTKGSGSGCVYLQTSLKYNILPVADGKAPFALQVN TLPLNFDKAGDHRTFQIRINVSYTGERPSSNMVIV DVKMVSGFIPMKPSVKKLQDQPNIQRTEVNTNHVL IYIEKLTNQTLGFSFAVEQDIPVKNLKPAPIKVYD YYETDEFTVEEYSAPFSDGSEQGNA
Storage
-60C or below
Associated Disease
Multiple Sclerosis (MS), Glomerular Disease, Liver Disease
Entrez Gene
232345
Omim
103950
Swiss Prot
Q61838
Unigene
Mm.30151
Molecular Weight
166 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close