Fibrinogen, Porcine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Porcine
Amount 100mg
Host Porcine
ArtNr PF10911
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 80% by SDS-PAGE
Presentation
Liquid in 20 mM sodium citrate-HCl/ pH 7.4
(pH 7.2 + 0.2) containing 0.15 % Sodium Azide
Sequence
A Chain - MFSVRLFCLVLTVVGTVQMAEVQDK GEFLAEGGGVRGPRLTERHQSACKESDWPFCSDED WNIKCPSGCRMKGLIDEVNQDFTNRINKLKNSLF DYQKNNKDSSTLSRNIIELLRGDFSN ANNNDNIY SQVSEELRSRIEILKRKVLEKVQHIHLLQKNVRDQ LIEMKRLEVDIDIKIRS CKGSCSRALEHKVDLKD YENQQKQLDQVIAINLLPSRDRQYLPLIKISPLPD ITPADFKT QARETPPEWKALLETRQVKMVLERVG GDERTRGGSISHGP B Chain - MVSWDFQKLK IMKPLLLLLLCVFIIKAQAAIDYDEDEDGRPKVHV DARGHRPYDKRREEA PSLRPVAPPISAGGYQPRP AKVAIGQKKVERKPPDAGGCLHADPDLGVLCPTGC QLQDTL LKQERPIKTSIEELNSNIDSVSQSSSST FQYMTLLKRLWKDRQKQRRDNENVINEFSSEL EK HQLYIDETVNSNIPTNLRVLRAILENLRSKIQKLE SDVLAQMEYCRTPCTVTCNIPVV SGKECEEIIRN GGETSEMYLIQPSDSIEPYRVYCDMKTERGGWTVI QNRQDGSVDFGRKW DPYKQGFGNIATSADGKKYC GIPGEYWLGNDKISQLTRMGPTKLLIEMEDWEGGK VKAIY EGFTVQNEANKYQISLSKYKGTAGNALLE GASQLVGENRTMTIHNSMFFSTYDRDNDGWK TTD PRKQCSKEDGGGWWYNRCHAANPNGRYYWGGSYSW DMAKHGTDDGVVWMNWKGSWYS MKKMSMKIRPFF PEQ
Storage
-60C or below
Associated Disease
Blood Disorder, Cardiac
Entrez Gene
100626178, 100514354, 403164
Omim
134820, 134830, 134850
Swiss Prot
P14477, P14460
Molecular Weight
340 kDa
Amount: 100mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Instruction sheet

PF10911.pdf