Haptoglobin, Porcine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Porcine
Amount 0.1mg
Host Porcine
ArtNr PH30711
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, =90% by SDS-PAGE
Presentation
10mM Sodium Phosphate pH 7.2, 150Mm NaCl
Sequence
MRALGAVVALLLCGQLFAAETGNEATDATDDSCPK PPEIPKGYVEHMVRYHCQTYYKLRT AGDGVYTLD SNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIM GGSLDAKGSFPWQAKM ISHHNLTSGATLINEQWL LTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVE IEKVIFH PDNSTVDIGLIKLKQKVPVNERVMPIC LPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYV M LPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILN EHTFCAGLSKYQEDTCYGDAGSAF AVHDKDDDTW YAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIA DN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
397061
Omim
140100
Swiss Prot
Q8SPS7
Unigene
Ssc.37
Molecular Weight
38 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close