Fibrinogen, Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 1mg
Host Rat
ArtNr PF10611
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 80% by SDS-PAGE
Presentation
Liquid in 20 mM sodium citrate-HCl/ pH 7.4
(pH 7.2 + 0.2) containing 0.15 % Sodium Azide
Sequence
A Chain - MLSLRVACLILSLASTVWTADTGTT SEFIEAGGDIRGPRIVERQPSQCKETDWPFCSDED WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLF DFQKNNKDSNSLTRNIMEYLRGDFAN ANNFDNTF GQVSEDLRRRIQILKRKVIEKAQQIQVLQKDVRDQ LIDMKRLEVDIDIKIRS CKGSCSRSVSREINLKD YEGQQKQLEQVIAKDLLPAKDRQYLPAIKMSPVPD LVPGSFKS QLQEGPPEWKALTEMRQMRMELERPG KDGASRGDLPGDSRGDSATRGPGSKIENPMTPGH GGSGYWRPGSSGSGSDGNWGSGTTGSDDTGTWGAG SSRPSSGSGNLKPSNPDWGEFSEFG GSSSPATRK EYHTGKLVTSKGDKELLIGNEKVTSTGTSTTRRSC SKTITKTVLGNDGHRE VVKEVVTSDDGSDCGDGM DLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTS NFKEFGS KTSDSDIFTDIENPSSHVPEFSSSSKT STVRKQVTKSYKMADEAASEAHQEGDTRTTKRG R ARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFS VYCDQETSLGGWLLIQQRMDGSLN FNRTWQDYKR GFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELE DWAGKEAYAEYHFRV GSEAEGYALQVSSYQGTAG DALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEEN CAEVYG GGWWYNSCQAANLNGIYYPGGTYDPRNN SPYEIENGVLWVPFRGADYSLWAVRMKIRPLV GQ B Chain - MRHLWLLLLSVSLVQTQAATTDSD KVDLSIARGHRPVDRRKEEPPSLRPAPPPISGGGY R ARPAKVDAGQKKVERKPPDAGGCVHGDGDMGVL CPTGCELRQTLLNHERPIKNSIAELNS NINSVSE TSSVTFQYLTLLKDMWKKKQAQVKDNENVINEYSS ILEDQKLYIDETVNDNIP LNLRVLRSILEDLRSK IQKLESDISAQTEYCHTPCTVNCNIPVVSGKECEE IIRKGGETS EMYLIQPDTSSKPYRVYCDMKTENG GWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDT KKYCGLPGEYWLGNDKISQLTRIGPTELLIEMED WKGDKVKAHYGGFTVQTEANKYQVSV NKYKGTAG NALMEGASQLVGENRTMTIHNGMFFSTYDRDNDGW VTTDPRKQCSKEDGGGW WYNRCHAANPNGRYYWG GLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKI RPVFPQQ G Chain - MNWSLQLRSFILCWALL LLSPTGLAQYTATRDNCCILDERFGSYCPTTCGIS DFLNSYQT DVDTDLQTLENILQRAENRTTEAKEL IKAIQVYYNPDQPPKPGMIEGATQKSKKMVEEIL KYEALLLTHESSIRYLQDIYTSNKQKITNLKQKVA QLEAQCQEPCKDSVRIHDTTGKDCQ DIANKGAKE SGLYFIRPLKATQQFLVYCEIDGSGNGWTVLQKRL DGSVDFKKNWIQYKEG FGHLSPTGTTEFWLGNEK IHLISMQSTIPYALRIQLKDWSGRTSTADYAMFRV GPESDKY RLTYAYFIGGDAGDAFDGYDFGDDPSD KFFTSHNGMHFSTWDNDNDKFEGNCAEQDGSGW W MNKCHAGHLNGVYYQGGTYSKSSTPNGYDNGIIWA TWKTRWYSMKETTMKIIPFNRLSI GDGQQHHMGG SKQVSVEHEVDVEYP
Storage
-60C or below
Associated Disease
Blood Disorder, Cardiac
Entrez Gene
361969, 24366, 24367
Omim
134820, 134830, 134850
Swiss Prot
P14480, P06399, P02680
Unigene
Rn.11416, Rn.98846, Rn. 1702
Molecular Weight
340 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close