Fibronectin, Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 1mg
Host Rat
ArtNr PF50451
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
Liquid in 10 mM HEPES/0.15 M NaCl/pH 7.5

(pH 7.2 + 0.3) containing 0.15 % Sodium Azide
Sequence
MLRGPGPGRLLLLAVLCLGTSVRCTETGKSKRQAQ QIVQPPSPVAVSQSKPGCFDNGKHY QINQQWERT YLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG NTYKVGDTYERPKDSM IWDCTCIGAGRGRISCTI ANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGN GKGEWTC KPIAEKCFDHAAGTSYVVGETWEKPYQ GWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS Y RIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHVL QSASAGSGSFTDVRTAIYQPQTHP QPAPYGHCVT DSGVVYSVGMQWLKSQGDKQMLCTCLGNGVSCQET AVTQTYGGNSNGEPC VLPFHYNGRTFYSCTTEGR QDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGN SNGALC HFPFLYSNRNYSDCTSEGRRDNMKWCGT TQNYDADQKFGFCPMAAHEEICTTNEGVMYRI GD QWDKQHDLGHMMRCTCVGNGRGQWACIPYSQLRDQ CIVDDITYNVNDTFHKRHEEGHM LNCTCFGQGRG RWKCDPIDRCQDSETRTFYQIGDSWEKFVHGVRYQ CYCYGRGIGEWHCQ PLQTYPGTTGPVQVIITETP SQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWK EATIP GHLNSYTIKGLTPGVIYEGQLISIQQYGH QEVTRFDFTTSASTPVTSNTVTGETAPFSPV VAT SESVTEITASSFVVSWVSASDTVSGFRVEYELSEE GDEPQYLDLPSTATSVNIPDLL PGRKYIVNVYQI SEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIV VRWSRPQAPITGY RIVYSPSVEGSSTELNLPETA NSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQE TTGV PRSDDVPAPKDLQFVEVTDVKVTIMWTPPN SAVTGYRVDVLPVNLPGEHGQRLPVNRNTF AEVT GLSPGVTYLFKVFAVHQGRESKPLTAQQTTKLDAP TNLQFVNETDRTVLVTWTPPR ARIAGYRLTVGLT RGGQPKQYNVGPMASKYPLRNLQPGSEYTVTLMAV KGNQQSPKATGV FTTLQPLRSIPPYNTEVTETTI VITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSI VVS GLTPGVEYTYTIQVLRDGQERDAPIVNRVVT PLSPPTNLHLEANPDTGVLTVSWERSTTP DITGY RITTTPTNGQQGTALEEVVHADQSSCTFENRNPGL EYNVSVYTVKDDKESAPISD TVIPEVPQLTDLSF VDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIP IFEDFVDSSVG YYTVTGLEPGIDYDISVITLING GESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWA PP PSIELTNLLVRYSPVKNEEDVAELSISPSDNA VVLTNLLPGTEYLVSVSSVYEQHESIPL RGRQKT GLDSPTGFDSSDVTANSFTVHWVAPRAPITGYIIR HHAEHSAGRPRQDRVPPSR NSITLTNLNPGTEYI VTIIAVNGREESPPLIGQQSTVSDVPRDLEVIAST PTSLLISWEP PAVSVRYYRITYGETGGNSPVQEF TVPGSKSTATINNIKPGADYTITLYAVTGRGDSPA S SKPVSINYQTEIDKPSQMQVTDVQDNSISVRWL PSTSPVTGYRVTTAPKNGLGPTKSQTV SPDQTEM TIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNI DRPKGLAFTDVDVDSIKI AWESPQGQVSRYRVTY SSPEDGIHELFPAPDGDEDTAELHGLRPGSEYTVS VVALHGGME SQPLIGVQSTAIPAPTNLKFTQVSP TTLTAQWTAPSVKLTGYRVRVTPKEKTGPMKEINL SPDSTSVIVSGLMVATKYEVSVYALKDTLTSRPA QGVVTTLENVSPPRRARVTDATETTI TISWRTKT ETITGFQVDAIPANGQTPVQRTISPDVRSYTITGL QPGTDYKIHLYTLNDNA RSSPVVIDASTAIDAPS NLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGS PPREVVPR PRPGVTEATITGLEPGTEYTIYVIAL KNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI LDVPSTVQKTPFVTNPGYDTENGIQLPGTSHQQPS VGQQMIFEEHGFRRTTPPTAATPVR LRPRPYLPN VDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQE ALSQTTISWTPFQESS EYIISCQPVGTDEEPLQF QVPGTSTSATLTGLTRGVTYNIIVEALHNQRRHKV REEVVTV GNTVNEGLNQPTDDSCFDPYTVSHYAV GEEWERLSDSGFKLTCQCLGFGSGHFRCDSSKW C HDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEF KCDPHEATCYDDGKTYHVGEQWQK EYLGAICSCT CFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYT QRYHQRTNTNVNCPI ECFMPLDVQADRDDSRE
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
25661
Omim
135600
Swiss Prot
P04937
Unigene
Rn.1604
Molecular Weight
220 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close