Haptoglobin, Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 0.1mg
Host Rat
ArtNr PH30721
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
10mM Sodium Phosphate pH 7.2, 150mM NaCl
Sequence
MRALGAVVTLLLWGQLFAVELGNDATDIEDDSCPK PPEIANGYVEHLVRYRCRQFYKLQT EGDGIYTLN SEKQWVNPAAGDKLPKCEAVCGKPKHPVDQVQRII GGSMDAKGSFPWQAKM ISRHGLTTGATLISDQWL LTTAQNLFLNHSENATAKDIAPTLTLYVGKNQLVE IEKVVLH PERSVVDIGLIKLKQKVLVTEKVMPIC LPSKDYVAPGRMGYVSGWGRNVNFRFTERLKYV M LPVADQEKCELHYEKSTVPEKKGAVSPVGVQPILN KHTFCAGLTKYEEDTCYGDAGSAF AVHDTEEDTW YAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMA KN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
24464
Omim
140100
Swiss Prot
P06866
Unigene
Rn.10950
Molecular Weight
39 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close