« Back
Home /
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Item no.	BM-RPC24579-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Oncology By Cell Type Hematology Leukemia Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Purity	> 90% by SDS-PAGE
Sequence	LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSW LRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISG AKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYF SNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVS PRSEVCRTSAGSAVDTSRLDFACN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CD8a
Available
Manufacturer - Conjugate / Tag	N-terminal 6x His Tag
Molecular Weight (Theoretical)	19.9 kDa
Expression Region	26-189aa
Manufacturer - Gene Name	CD8A
Sequence Information	Extracellular Domain

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer