Item no. |
BM-RPC21173-50ug |
Manufacturer |
Biomatik
|
Amount |
50 UG |
Category |
|
Type |
Proteins |
Specific against |
Human (Homo sapiens) |
Host |
E.coli |
Conjugate/Tag |
Unconjugated |
Purity |
>90% by SDS-PAGE |
Sequence |
ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLC |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CGD91-phoxCytochrome b(558) subunit beta |
Shipping condition |
Cool pack |
Available |
|
Specificity |
Human (Homo sapiens) |
Manufacturer - Category |
Protein |
Manufacturer - Targets |
CYBB |
Manufacturer - Conjugate / Tag |
Unconjugated / N-Terminal 6Xhis-Tagged |
Shipping Temperature |
Ice packs |
Storage Conditions |
-20°C. Avoid repeated freeze/thaw cycles. |
Molecular Weight (Theoretical) |
37.2kDa |
Manufacturer - Research Area |
Immunology |
Protein Length |
Partial |
Protein Type |
Recombinant Protein |
Expression Region |
283~570aa |
Restrictions |
For Research Use Only. Not for use in diagnostic procedures. |
Expiration |
12 months |
Reconstitution |
Refer to the datasheet/CoA included in the product pouch. |
Endotoxin |
Not Tested |
Quality Systems |
This product is manufactured at ISO 9001 certified facilities. |
Quality Guarantee |
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. |
Long Description |
Recombinant Human Cytochrome b-245 heavy chain (CYBB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYBB. Target Synonyms: CGD91-phoxCytochrome b(558) subunit beta. Accession Number: P04839. Expression Region: 283~570aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
Short Description |
Recombinant Human Cytochrome b-245 heavy chain (CYBB), partial is a purified Recombinant Protein. |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Activity |
Not Tested |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.