« Back
Home /
Recombinant Human Gastrotropin (FABP6)

Recombinant Human Gastrotropin (FABP6)

Item no.	BM-RPC21297-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport
Type	Proteins
Specific against	Human (Homo sapiens)
Sequence	MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNF KIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKES NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIV GDKLVEVSTIGGVTYERVSKRLA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fatty acid-binding protein 6, Ileal lipid-binding protein
Available
Manufacturer - Conjugate / Tag	N-terminal GST Tag
Molecular Weight (Theoretical)	41.4 kDa
Expression Region	1-128aa
Manufacturer - Gene Name	FABP6
Sequence Information	Full Length of BC022489

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time