« Back
Home /
Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Item no.	BM-RPC21668-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development By Cell Type Blastoma Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation Viability By Organ Lung Cancer Bladder Cancer Breast Cancer Testicular & Prostate Cancer Cytoskeleton Markers
Type	Proteins
Specific against	Human (Homo sapiens)
Sequence	NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKR CLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGK GEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTR SVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6x His Tag
Molecular Weight (Theoretical)	19.3 kDa
Expression Region	3120-3256aa
Manufacturer - Gene Name	MKI67
Sequence Information	Partial Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 1/15/2026

Compare

Add to wishlist

Get an offer

Request delivery time