« Back
Home /
Recombinant Human Ropporin-1B (ROPN1B), partial

Recombinant Human Ropporin-1B (ROPN1B), partial

Item no.	BM-RPC21939-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Oncology By Cell Type Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human (Homo sapiens)
Sequence	MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALAC SALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQ FLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGL ITVNDFTQNPRVWLE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Rhophilin-associated protein 1B
Available
Manufacturer - Conjugate / Tag	Unconjugated, N-Terminal 6Xhis-Tagged
Molecular Weight (Theoretical)	40.6 kDa
Expression Region	1-120aa
Manufacturer - Gene Name	ROPN1B
Sequence Information	Partial Length of Isoform 2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer