« Back
Home /
Recombinant Human Zinc finger protein 160 (ZNF160)

Recombinant Human Zinc finger protein 160 (ZNF160)

Item no.	BM-RPC22251-1mg
Manufacturer	Biomatik
Amount	1 mg
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Schwann Cell Markers
Type	Proteins
Specific against	Human (Homo sapiens)
Sequence	MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRD VMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVK SCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGI CCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCD KRVGSIF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Zinc finger protein HZF5, Zinc finger protein Kr18, Short name: HKr18
Available
Manufacturer - Conjugate / Tag	N-terminal 10x His Tag and C-terminal Myc Tag
Molecular Weight (Theoretical)	22.1 kDa
Expression Region	1-147aa
Manufacturer - Gene Name	ZNF160
Sequence Information	Full Length of Isoform 2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/9/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer