« Back
Home /
Recombinant Human C-X-C motif chemokine 10 protein (CXCL10)

Recombinant Human C-X-C motif chemokine 10 protein (CXCL10)

Item no.	BM-RPC24110-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human (Homo sapiens)
Sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	10KDA interferon gamma-induced protein, Gamma-IP10, IP-10Small-inducible cytokine B10
Available
Manufacturer - Conjugate / Tag	N-terminal 6x His Tag
Molecular Weight (Theoretical)	12.6 kDa
Expression Region	22-98aa
Manufacturer - Gene Name	CXCL10
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time