« Back
Home /
Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial

Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial

Item no.	BM-RPC24561-1mg
Manufacturer	Biomatik
Amount	1 mg
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Type	Proteins
Specific against	Mouse (Murine, Mus musculus)
Purity	> 90% by SDS-PAGE
Sequence	QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPV IYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQD NPDRASSVYTRSTGEHEVSTGL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MIP-1 alpha receptor, CD_antigen: CD195
Available
Manufacturer - Conjugate / Tag	N-terminal 6x His Tag
Molecular Weight (Theoretical)	12.6 kDa
Expression Region	263-354aa
Manufacturer - Gene Name	Ccr5
Sequence Information	Partial Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer