« Back
Home /
Recombinant Conus vexillum Alpha-conotoxin VxXXC

Recombinant Conus vexillum Alpha-conotoxin VxXXC

Item no.	BM-RPC22390-1mg
Manufacturer	Biomatik
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Sequence	DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTC AYNWRRGIYCSC
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VxXIIC
Available
Manufacturer - Conjugate / Tag	N-terminal 10x His-SUMO Tag and C-terminal Myc Tag
Molecular Weight (Theoretical)	25.3 kDa
Expression Region	1-47aa
Manufacturer - Gene Name	N/A
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 7/3/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail