Item no. |
BM-RPC22878-1mg |
Manufacturer |
Biomatik
|
Amount |
1 mg |
Category |
|
Type |
Proteins |
Specific against |
Mycobacterium tuberculosis |
Host |
E.coli |
Conjugate/Tag |
Unconjugated, Myc, SUMO |
Purity |
>85% by SDS-PAGE |
Sequence |
METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDVVSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYHTSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQRGSGVALRLDDGCTI |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Mycothiol-disulfide reductaseNADPH-dependent mycothione reductase |
Shipping condition |
Cool pack |
Available |
|
Specificity |
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
Manufacturer - Category |
Protein |
Manufacturer - Targets |
mtr |
Manufacturer - Conjugate / Tag |
Unconjugated, N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged |
Shipping Temperature |
Ice packs |
Storage Conditions |
-20°C. Avoid repeated freeze/thaw cycles. |
Molecular Weight (Theoretical) |
69.9kDa |
Protein Length |
Full Length |
Protein Type |
Recombinant Protein |
Expression Region |
1~459aa |
Restrictions |
For Research Use Only. Not for use in diagnostic procedures. |
Expiration |
12 months |
Reconstitution |
Refer to the datasheet/CoA included in the product pouch. |
Endotoxin |
Not Tested |
Quality Systems |
This product is manufactured at ISO 9001 certified facilities. |
Quality Guarantee |
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. |
Long Description |
Recombinant Mycobacterium tuberculosis Mycothione reductase (mtr) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target Name: mtr. Target Synonyms: Mycothiol-disulfide reductaseNADPH-dependent mycothione reductase. Accession Number: P9WHH2. Expression Region: 1~459aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 69.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
Short Description |
Recombinant Mycobacterium tuberculosis Mycothione reductase (mtr) is a purified Recombinant Protein. |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Activity |
Not Tested |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.