Comparison

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial

Item no. BM-RPC25279-100ug
Manufacturer Biomatik
Amount 100 UG
Category
Type Proteins
Specific against Bacillus thuringiensis
Host Yeast
Conjugate/Tag Unconjugated
Purity >90% by SDS-PAGE
Sequence HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 130 kDa crystal protein, Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
Shipping Condition Cool pack
Available
Specificity Bacillus thuringiensis subsp. kurstaki
Manufacturer - Category
Protein
Manufacturer - Targets
cry1Ab
Manufacturer - Conjugate / Tag
Unconjugated, N-Terminal 6Xhis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)
17.3kDa
Protein Length
Partial
Protein Type
Recombinant Protein
Expression Region
1022~1155aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures.
Expiration
12 months
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Endotoxin
Not Tested
Quality Systems
This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ab. Target Synonyms: 130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b). Accession Number: P0A370. Expression Region: 1022~1155aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial is a purified Recombinant Protein.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Activity
Not Tested

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 UG
Available: In stock
available

Delivery expected until 1/1/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close