« Back
Home /
Rabbit polyclonal antibody to Presenilin 2 loop region: IgG

Rabbit polyclonal antibody to Presenilin 2 loop region: IgG

Item no.	R-1681-500
Manufacturer	Biosensis
Amount	500ug
Category	Neuroscience Protein Aggregation, Clearance & Misfolding Antibodies Immunoprecipitation Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IP
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	AD3LP, AD5, E5-1, STM-2
Available
Sub category	Alzheimer's / Parkinson's
products_extra_fields_value	Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
products_quantity	200
storage	Short term storage at 2-8AC for one week. At -20AC as an undiluted liquid for up to 12 months.
formulation	Lyophilized
immunogen	A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
conality	Rabbit
specificity	Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
reconstitution	Reconstitute in 500 AuL of sterile water. Centrifuge to remove any insoluble material.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 16 days

Compare

Add to wishlist

Get an offer