« Back
Home /
MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged

MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged

Item no.	BTZ-30100113
Manufacturer	BioTeZ
Amount	200 ug/1 ml
Category	Oncology Neuroscience Neuroinflammation Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	His
Protein Family	Matrix Metalloproteinases, matrixins
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	> 90 %
Product Subcategory	EC 3.4.24.80
Pathway and Disease	Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion
Description	MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
Applications Info	Investigation of MT1-MMP, Generation of MT1-MMP catalytic domain, Progelatinase A activation, inhibitor screening, antigen standard,
Alternate Names	Membrane-Type-1 Matrix Metalloproteinase
Sequence	SLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSP QSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRC GVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCI QNYTPKVGEYATYEAIRKAFRVWESATPLRFREVP YAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGF LAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDI FLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTEN FVLPDDDRRGIQQLYGGESGLVTHHHHHH
Accession No	P50281
Composition	50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.
Storage	Store at -70C
Target Modification	No
Expression System	E.coli
Product Subtype	protein fragment
Active?	Yes
Tag	His-tagged
Gene ID	4323
Molecular Weight	31 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant MT1-MMP prodomain-catalytic domain is produced as a periplasmic protein in E. coli.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	MMP14 (partial)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug/1 ml

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer