« Back
Home /
MMP 9 Monomer (Progelatinase B)

MMP 9 Monomer (Progelatinase B)

Item no.	BTZ-30100502
Manufacturer	BioTeZ
Amount	10 ug/200ul
Category	Oncology Neuroscience Neuroinflammation Neural Signaling Peptides & Proteins Native Proteins
Type	Proteins Native
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Matrix Metalloproteinases, matrixins
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	> 95%
Product Subcategory	EC 3.4.24.35
Pathway and Disease	Diseases associated with MMP9 include Metaphyseal Anadysplasia 2 and Metaphyseal Anadysplasia. Among its related pathways are Pathways in cancer and Integrin Pathway.
Description	MMP9 may play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Applications Info	Degradation of extracellular Matrix, Screening and evaluation of MMP inhibitors, Antigen standard
Alternate Names	Matrix Metalloproteinase 9, Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase
Sequence	MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDL RTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPA LLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLG RFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDA FARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEH GDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELW SLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACT TDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQD GNADGKPCQFPFIFQGQSYS
Accession No	P14780
Composition	50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 1 uM ZnCl2, 0.05 % Brij-35, 0.05 % NaN3
Storage	Store at -70C
Target Modification	Yes
Expression System	Human Blood
Product Subtype	full length
Active?	Yes, after Trypsin activation
Tag	untagged
Gene ID	4318
Molecular Weight	92 kDa
Shipping Temp Min	dry ice
Product description long	Progelatinase B monomer is isolated from human blood. The preparation is free from gelatinase B dimer and from complexes of gelatinase B with TIMP-1 or lipocalin.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	MMP9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug/200ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer