« Back
Home /
MMP 13 (Procollagenase 3), His-tagged

MMP 13 (Procollagenase 3), His-tagged

Item no.	BTZ-30100802
Manufacturer	BioTeZ
Amount	10 ug/50ul
Category	Neuroscience Neuroinflammation Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Stainings ECM
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	His
Protein Family	Matrix Metalloproteinases, matrixins
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	>95%
Product Subcategory	EC 3.4.24.35
Pathway and Disease	Diseases associated with MMP13 include Spondyloepimetaphyseal Dysplasia, Missouri Type and Metaphyseal Dysplasia, Spahr Type. Among its related pathways are Integrin Pathway and Development_Glucocorticoid receptor signaling.
Description	MMP13 plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion
Applications Info	Degradation of extracellular Matrix, Screening and evaluation of MMP inhibitors, Antigen standard
Alternate Names	Matrix Metalloproteinase 13 (Procollagenase 3)
Sequence	MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEED LQFAERYLRSYYHPTNLAGILKENAASSMTERLRE MQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYN VFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKK AFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDF YPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSS SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYT YTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKT PDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQ QVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIF RGRKFWALNGYDILEGYPKKISELGLPKEVKKISA AVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRL IEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSI WSNRIVRVMPANSILWCHHHHHH
Accession No	P45452
Composition	50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
Storage	Store at -70C
Target Modification	No
Expression System	Insect Cell
Product Subtype	full length
Active?	Yes, after APMA activation
Tag	His-tagged
Gene ID	4322
Molecular Weight	60 kDa
Shipping Temp Min	dry ice
Product description long	Human recombinant procollagenase-3 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	MMP13

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug/50ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer