« Back
Home /
MMP 3 (Stromelysin 1) catalytic domain

MMP 3 (Stromelysin 1) catalytic domain

Item no.	BTZ-30102002
Manufacturer	BioTeZ
Amount	10 ug/200ul
Category	Neuroscience Neuroinflammation Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Matrix Metalloproteinases, matrixins
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	>90 %
Product Subcategory	EC 3.4.24.17
Pathway and Disease	Diseases associated with MMP3 include Coronary Heart Disease 6 and Arthritis. Among its related pathways are Integrin Pathway and Signaling by GPCR.
Description	MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.
Applications Info	Degradation of extracellular Matrix, Screening and evaluation of MMP inhibitors, Antigen standard
Alternate Names	Matrix Metalloproteinase 3 (Stromelysin 1, Progelatinase)
Sequence	FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAV EKALKVWEEVTPLTFSRLYEGEADIMISFAVREHG DFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT KDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPL YHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPL VPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIF KDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAY EVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTL GFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEK RNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYF FTGSSQLEFDPNAKKVTHTLKSNSWLNCMG
Accession No	P08254
Composition	50 mM Tris-HCl, pH 7.5, 10 mM CaCl2, 1 uM ZnCl2, 0.05% NaN3
Storage	Store at -70C
Target Modification	No
Expression System	E.coli
Product Subtype	protein fragment
Active?	Yes
Tag	untagged
Gene ID	4314
Molecular Weight	22 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant catalytic domain of MMP 3 is expressed in E. coli and contains MMP 3 residues F100-P273 (SWISS-PROT: P08254) and two additional residues, M and G, at the N-terminus.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	MMP3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug/200ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer