TIMP 1

Item no.	BTZ-30111003
Manufacturer	BioTeZ
Amount	200 ug/1 ml
Category	Neuroscience Neural Signaling Peptides & Proteins Native Proteins
Type	Proteins Native
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Natural inhibitor of the matrix metalloproteinases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	>90%
Pathway and Disease	Diseases associated with TIMP1 include Chronic Venous Leg Ulcers and Oral Submucous Fibrosis. Among its related pathways are p70S6K Signaling and CREB Pathway
Description	TIMP1 is a metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
Applications Info	TIMP1 is used to inhibit matrix metalloproteinases
Alternate Names	Tissue Inhibitor Of Metalloproteinases 1, Fibroblast Collagenase Inhibitor, Erythroid-Potentiating Activity
Sequence	MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAF CNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYK GFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEE FLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFT KTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLL QGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Accession No	P01033
Composition	50 mM Tris-HCl, pH 7, 200 mM NaCl, 5 mM CaCl2, 1 uM ZnCl2, 0.05%Brij 35, 0.05% NaN3
Storage	Store at -70C
Target Modification	Yes
Expression System	human neutrophil granulocytes
Product Subtype	full length
Active?	No
Tag	untagged
Gene ID	7076
Molecular Weight	28 kDa
Shipping Temp Min	dry ice
Product description long	The human tissue inhibitor of matrix metalloproteinases TIMP-1 is expressed in Sf9 cells.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	TIMP1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug/1 ml

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer