« Back
Home /
Recombinant Human R-spondin-1 (RSPO1), partial , Active Protein

Recombinant Human R-spondin-1 (RSPO1), partial , Active Protein

Item no.	BM-RPC30270-20ug
Manufacturer	Biomatik
Amount	20 ug
Specific against	Human (Homo sapiens)
Host	Mammalian cells
Purity	>95% by SDS-PAGE
Sequence	RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Alias	Roof plate-specific spondin-1, hRspo1
Shipping condition	Cool pack
Available
Specificity	Human (Homo sapiens)
Manufacturer - Category	Protein
Manufacturer - Targets	R-spondin-1 (RSPO1)
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 6xHis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	30.2kDa
Manufacturer - Research Area	Developmental Biology
Protein Length	Partial
Protein Type	Active Recombinant Protein
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	<1.0 EU/ug, by LAL method
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Human R-spondin-1 (RSPO1), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: R-spondin-1 (RSPO1) . Accession Number: Q2MKA7; RSPO1. Expression Region: 31-263aa. Tag Info: C-terminal 10xHis-Avi-tagged. Theoretical MW: 30.2kda. Target Synonyms: Roof plate-specific spondin-1; hRspo1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Human R-spondin-1 (RSPO1), partial , Active Protein is a purified Active Recombinant Protein.
Activity	Biologically Active

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 6/26/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail