« Back
Home /
Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

Item no.	BM-RPC31644-1mg
Manufacturer	Biomatik
Amount	1 mg
Specific against	Bordetella pertussis
Host	E.coli
Conjugate/Tag	Unconjugated
Purity	>85% by SDS-PAGE
Sequence	DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Alias	PTX S1, Islet-activating protein S1, IAP S1, NAD-dependent ADP-ribosyltransferase, EC 2.4.2
Shipping condition	Cool pack
Available
Specificity	Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Manufacturer - Category	Protein
Manufacturer - Targets	Pertussis toxin subunit 1 (ptxA)
Manufacturer - Conjugate / Tag	Unconjugated, N-Terminal 10xHis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	40.8kDa
Manufacturer - Research Area	Otherss
Protein Length	Full Length of Mature Protein
Protein Type	Recombinant Protein
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	Not Tested
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) 百日咳博德特菌. Target Name: Pertussis toxin subunit 1 (ptxA) . Accession Number: P04977; ptxA. Expression Region: 35-269aa. Tag Info: N-terminal 6xHis-B2M-tagged. Theoretical MW: 40.8kda. Target Synonyms: PTX S1; Islet-activating protein S1; IAP S1; NAD-dependent ADP-ribosyltransferase; EC 2.4.2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein.
Activity	Not Tested

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 5/29/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail