Comparison

Anti-Annexin VII/ANXA7 Antibody European Partner

Item no. BOS-A04889
Manufacturer Boster
Amount 100 ug/vial
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Annexin A7;Annexin VII;Annexin-7;Synexin;ANXA7;ANX7, SNX;OK/SW-cl.95;
Available
Storage Conditions
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Molecular Weight
52739 MW
Manufacturer - Gene Name
ANXA7
Gene Full Name
protein O-mannosyltransferase 2
Background
ANXA7 (Annexin A7), also known as ANX7 or SNX, is a protein that in humans is encoded by the ANXA7 gene. Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins. This gene is mapped to 10q21.1-q21.2 by study of somatic cell hybrids and by in situ hybridization. The ANX7 gene exhibits many biologic and genetic properties expected of a tumor suppressor gene and may play a role in prostate cancer progression. Based on studies of recombinant human ANXA7 and isolated bovine chromaffin cells, it is showed that ANXA7 is a Ca(2+)-dependent GTP binding protein. ANXA7 was active in a chromaffin granule aggregation assays in the presence of Ca(2+) and GTP, and was deactivated upon GTP hydrolysis.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.
Contents
Each vial contains 5 mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Concentration
Add 0.2 ml of distilled water will yield a concentration of 500ug/ml.
Manufacturer - Research Category
|signal transduction|cytoskeleton / ecm|cell adhesion|annexins| signal transduction|signaling pathway|calcium signaling|calcium channels
Protein Name
Annexin A7
Protein Function
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Tissue Specificity
Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.