Comparison

Anti-Cardiac FABP/FABP3 Antibody European Partner

Item no. BOS-PB9759
Manufacturer Boster
Amount 100 ug/vial
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Fatty acid-binding protein, heart;Fatty acid-binding protein 3;Heart-type fatty acid-binding protein;H-FABP;Mammary-derived growth inhibitor;MDGI;Muscle fatty acid-binding protein;M-FABP;FABP3;FABP11, MDGI;
Available
Storage Conditions
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Molecular Weight
14858 MW
Manufacturer - Gene Name
FABP3
Gene Full Name
DNA damage-binding protein 2
Background
Heart-type fatty acid binding protein (hFABP), also known as mammary-derived growth inhibitor, is a protein that in humans is encoded by the FABP3 gene. The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is also a candidate tumor suppressor gene for human breast cancer. Cardiac-type fatty acid-binding protein (cFABP) from human heart muscle of three individuals was isolated and characterized as pI 5.3-cFABP.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.
Contents
Each vial contains 5 mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Concentration
Add 0.2 ml of distilled water will yield a concentration of 500ug/ml.
Manufacturer - Research Category
|cardiovascular|lipids / lipoproteins|fatty acids|binding proteins| stem cells|mesenchymal stem cells|myogenesis| metabolism|pathways and processes|metabolic signaling pathways|lipid and lipoprotein metabolism|redox metabolism|fatty acid oxidation
Protein Name
Fatty acid-binding protein, heart
Protein Function
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Predicted Reactivity
Hamster

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug/vial
Available: Out of stock
Questions about this Product?