« Back
Home /
Recombinant Measles virus Hemagglutinin glycoprotein (H), partial

Recombinant Measles virus Hemagglutinin glycoprotein (H), partial

Item no.	BM-RPC25932-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	H
Uniprot	P08362
Source	E.coli
Expression Region	303-617aa
AA Sequence	EDSITIPYQGSGKGVSFQLVKLGVWKSPTDMQSWV PLSTDDPVIDRLYLSSHRGVIADNQAKWAVPTTRT DDKLRMETCFQQACKGKIQALCENPEWAPLKDNRI PSYGVLSVDLSLTVELKIKIASGFGPLITHGSGMD LYKSNHNNVYWLTIPPMKNLALGVINTLEWIPRFK VSPYLFNVPIKEAGEDCHAPTYLPAEVDGDVKLSS NLVILPGQDLQYVLATYDTSRVEHAVVYYVYSPSR SFSYFYPFRLPIKGVPIELQVECFTWDQKLWCRHF CVLADSESGGHITHSGMEGMGVSCTVTREDGTNRR
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	39.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Attaches the virus to cell receptors and thereby initiating infection. Binding of H protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion. May use human CD46 and/or SLAMF1 as receptors for viral entry into the cell. The high degree of interaction between H and MCP/CD46 results in down-regulation of the latter from the surface of infected cells, rendering them more sensitive to c3b-mediated complement lysis.
Function	Attaches the virus to cell receptors and thereby initiating infection. Binding of H protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion. May use human CD46 and/or SLAMF1 as receptors for viral entry into the cell. The high degree of interaction between H and MCP/CD46 results in down-regulation of the latter from the surface of infected cells, rendering them more sensitive to c3b-mediated complement lysis.
Subcellular location	Virion membrane, Single-pass type II membrane protein, Host cell membrane, Single-pass type II membrane protein
Protein Families	Paramyxoviruses hemagglutinin-neuraminidase family, Non-sialidase subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer