Comparison

GCM1 (glial cells missing homolog 1 (Drosophila)

Item no. 18-003-43307
Manufacturer GENWAY
Amount 0.05 mg
Category
Type Antibody
Applications WB
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-6A8F1C
Similar products 18-003-43307
Available
Genway ID:
GWB-6A8F1C
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human GCM1. Western Blot Suggested Antibody Titration: 0. 2 - 1 ug/ml
Positive Control:
HepG2
Note:
This is a rabbit polyclonal antibody against GCM1 validated on Western Blot. Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT. a novel sequence among known targets of DNA-binding proteins.
Function:
Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer.
Subcellular Location:
Nucleus (Potential).
Tissue Specificity:
Placenta specific.
Similarity:
Contains 1 GCM DNA-binding domain. Summary: This protein is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Chuang. H. C. . et al. . (2006) (er) Nucleic Acids Res. 34 (5). 1459-1469. Peptide
Sequence:
DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close