Comparison

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Item no. BM-RPC26966-1mg
Manufacturer Biomatik
Amount 1mg
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-Associated Protein, IAP, Protein MER6, CD47, MER6
Similar products CD47, IAP, MER6, Protein MER6, Antigenic Surface Determinant Protein OA3, Leukocyte Surface Antigen CD47, Integrin-Associated Protein
Available
Gene Name
CD47
Alternative Names
Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-Associated Protein, IAP, Protein MER6, CD47, MER6
Uniprot
Q08722
Source
Mammalian cell
Expression Region
19-139aa
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTE VYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEV SQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREG ETIIELKYRVVSWFSP
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
14.76 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 10 mM Tris-Citrate, 150 mM NaCl, 5% Mannitol, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD47(Integrin-Associated Protein, IAP) is a 40 ? 60 kDa variably glycosylated atypical member of the immunoglobulin superfamily. The ubiquitously expressed CD47 binds to SIRP family members on macrophages, neutrophils, and T cells. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Subcellular location
Cell membrane, Multi-pass membrane protein
Tissue Specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Delivery expected until 11/13/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close