« Back
Home /
Transthyretin (His-Tag)

Transthyretin (His-Tag)

Item no.	CSR-KN-TOYU-M01
Manufacturer	Cosmobio
Amount	1 mg
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Transthyetin(His-Tag)
Available
Manufacturer - Category	Biomolecules/Labeled Proteins/Hormone transport; Research Area/Disease/Alzheimer's Disease/Labeled Proteins; Research Area/Neurobiology/Neurodegeneration/Labeled Proteins; Research Area/Systemic Physiology/Endocrine & Metabolism/Labeled Proteins; Research Area/Disease/Amyloidosis/Labeled Proteins; Biomolecules/Hormone transport/Labeled Proteins; Research Area/Organs & Organ Systems/Thyroid/Labeled Proteins; Research Area/Organs & Organ Systems/Visual System/Labeled Proteins; Research Area/Systemic Physiology/Hormone transport/Labeled Proteins
Maker	CSR
Description	Recombinant Protein / Transthyretin (His-Tag) Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKE Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

CSR-KN-TOYU-M01.pdf

CSR-KN-TOYU-M01-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer