Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP875707HU-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q9HAV7 |
Gene Names |
GRPEL1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLE EKVKLEEQLKETVEKYKRALADTENLRQRSQKLVE EAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKD DNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVG AKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLH GRTLRPALVGVVKEA |
Expression Region |
1-217aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
48.3 kDa |
Alternative Name(s) |
HMGE Mt-GrpE#1 |
Relevance |
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. |
Reference |
"Identification and characterization of a human mitochondrial homologue of the bacterial co-chaperone GrpE." Choglay A.A., Chapple J.P., Blatch G.L., Cheetham M.E. Gene 267:125-134(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner (By similarity). Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins |
Subcellular Location |
Mitochondrion matrix |
Protein Families |
GrpE family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.